luxus ferienwohnung bernkastel kues

"action" : "rerender" "displaySubject" : "true", "initiatorBinding" : true, { "messageViewOptions" : "1111110111111111111110111110100101001101" ], LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "triggerEvent" : "click", { "action" : "pulsate" }, "event" : "addThreadUserEmailSubscription", ] "useSubjectIcons" : "true", { { "event" : "MessagesWidgetMessageEdit", { $(document).ready(function(){ { "event" : "MessagesWidgetEditCommentForm", ] "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ] "action" : "rerender" "action" : "rerender" "parameters" : { "actions" : [ ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/21833","ajaxErrorEventName":"LITHIUM:ajaxError","token":"W1hxbvG8kMJijToRlwqzbx4AC6O7VH4A7GCKJgk3UEY. "action" : "addClassName" "context" : "envParam:feedbackData", Sobald eine Komponente den HDCP-Schutz nicht verarbeiten kann, ist das Abspielen unserer Videos nicht gewährleistet. "actions" : [ { "event" : "MessagesWidgetMessageEdit", "actions" : [ { } { ] "action" : "pulsate" }, { "context" : "envParam:quiltName", if ( key == neededkeys[0] ) { "context" : "", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); ] "context" : "", "action" : "rerender" "disableLinks" : "false", "eventActions" : [ "initiatorBinding" : true, "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "useSubjectIcons" : "true", "event" : "MessagesWidgetEditAction", "includeRepliesModerationState" : "false", watching = true; "event" : "unapproveMessage", }); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { } ] ], { ] "event" : "AcceptSolutionAction", lithadmin: [] ] { "displaySubject" : "true", }, "actions" : [ { "useSimpleView" : "false", { "action" : "rerender" ] "context" : "", ] "action" : "rerender" "event" : "RevokeSolutionAction", return; "actions" : [ "disableKudosForAnonUser" : "false", "event" : "markAsSpamWithoutRedirect", }, LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":784,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXD1QMBFdUAFIMChgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQB1YBVlUOBxQEUwQBSQECUgBID1BYBU8GVV1QVVcCBAMHCVRAThUPVn1bVgB\/AhsIQCNFB11aQmERWQNLRwwFRAlQX1BHC1EDV3sMFlIWW1ZAZjNiA1UQTkBcB2dWR0YzBDdMVxAbFV4XYHF+IHUyGVsGQnE2en4UXwBFFVhVBxEXM312ZndFQglJWwFMXgAIDBR+LHsvbRJdQEoZ"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "disallowZeroCount" : "false", "includeRepliesModerationState" : "false", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" ] ] } "context" : "", } "action" : "rerender" "initiatorBinding" : true, "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", })(LITHIUM.jQuery); $(document).ready(function(){ ] "componentId" : "kudos.widget.button", ] "context" : "", "event" : "addMessageUserEmailSubscription", ] ] { { "context" : "", ] "context" : "envParam:selectedMessage", { "context" : "", { ] "context" : "", "actions" : [ "actions" : [ "componentId" : "kudos.widget.button", ] } }, "action" : "rerender" UHD 414S Quattro LNB für einen Multischalter ausgesucht und installiert. "selector" : "#messageview_7", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); }, }, Sat.1, Pro7 usw. } else { ] LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "rerender" ], } } "context" : "envParam:selectedMessage", { "context" : "", ] "eventActions" : [ { "event" : "markAsSpamWithoutRedirect", "actions" : [ { ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'Io-kBOofHIxVyixpa3b42xGrsvlkrLILT5B2eIkhZf0. { "context" : "", "event" : "unapproveMessage", "context" : "envParam:quiltName,message", "event" : "MessagesWidgetEditAction", })(LITHIUM.jQuery); "event" : "ProductAnswerComment", "context" : "", { "context" : "envParam:feedbackData", }, $(document).ready(function(){ { "event" : "MessagesWidgetEditAnswerForm", { }, ] } } "includeRepliesModerationState" : "false", ] } { ', 'ajax'); "actions" : [ "action" : "rerender" } { createStorage("false"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); { } { { } Bist du sicher, dass du fortfahren möchtest? "actions" : [ var keycodes = { Leider ist RTL-HD nicht kostenlos über DVB-T2 empfangbar. }, "context" : "envParam:quiltName,product,contextId,contextUrl", }, { "actions" : [ { window.onclick = function(event) { { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'dqSypRDrUTL4ChSKEiNf8MKDvZIDZru2FDvK6BSPeYA. "event" : "MessagesWidgetEditAction", "context" : "", { { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" }, "action" : "rerender" "disableKudosForAnonUser" : "false", "event" : "deleteMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { }, { "event" : "addMessageUserEmailSubscription", } "context" : "", { { "action" : "rerender" "event" : "addMessageUserEmailSubscription", { ], }, "context" : "", { ] } // Oops, not the right sequence, lets restart from the top. ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":896959,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "componentId" : "kudos.widget.button", "event" : "MessagesWidgetEditCommentForm", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "truncateBody" : "true", "actions" : [ "action" : "rerender" "componentId" : "forums.widget.message-view", "action" : "rerender" ] "action" : "rerender" ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "event" : "removeThreadUserEmailSubscription", "event" : "expandMessage", { LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); } { } "eventActions" : [ { ] "context" : "envParam:quiltName", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "eventActions" : [ "action" : "rerender" "context" : "", { "actions" : [ "context" : "", { }, $(document).ready(function(){ }, ] }, "actions" : [ { "disableLinks" : "false", "context" : "", } "componentId" : "forums.widget.message-view", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "disallowZeroCount" : "false", { "actions" : [ LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] { "quiltName" : "ForumMessage", { "revokeMode" : "true", "disableLabelLinks" : "false", "actions" : [ ], { "displaySubject" : "true", }, ] { { "actions" : [ }, { "action" : "rerender" "context" : "", { "selector" : "#kudosButtonV2_6", { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":896958,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", "context" : "", "context" : "", "entity" : "896960", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "actions" : [ ;(function($) { "context" : "", ] watching = false; }, "action" : "rerender" ] LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "addThreadUserEmailSubscription", { { "actions" : [ ] } "action" : "rerender" }); element.siblings('li').find('li').removeClass('active'); } else { { "event" : "MessagesWidgetEditAnswerForm", } "context" : "", ] } "event" : "deleteMessage", "context" : "", ] }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ;(function($) { }, "action" : "rerender" "actions" : [ } "actions" : [ }, "useCountToKudo" : "false", ] LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetEditAnswerForm", { "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { }, ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'Fxo2gahrmTxmF1PPZcBGSxzQ5m3bzBFWsVQbgEIORTw. Gehen Sie dazu wie folgt vor: Sollte kein Fehler an Ihrem Anschluss vorliegen, sollten Sie die nachfolgenden Punkte nachprüfen: Sollten Sie immer noch keinen Empfang haben, empfehlen wir Ihnen, sich mit dem Kabel Deutschland Kundenservice in Verbindung zu setzen: Kabel Deutschland Ihre Bankverbindung ändern, Wie reich ist Thomas Gottschalk? }, { "action" : "pulsate" "context" : "envParam:entity", "action" : "rerender" "action" : "rerender" { { "kudosable" : "true", } LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "pulsate" { "action" : "rerender" "context" : "lia-deleted-state", }, "initiatorDataMatcher" : "data-lia-kudos-id" }); Seit schätzungsweise 3 Wochen tritt bei uns im Haus das Phänomen auf, daß bestimmte Sender (Sat 1, Pro 7, Kabel 1, Sat 1 Gold, Pro 7 Maxx, Welt, Kabel 1 Doku, eoTV, Arte, Onhe, Phönix, sowie ARD HD, ZDF HD und die ganzen Dritten Programme in HD, obwohl diese bis dahin empfangbar waren) nicht mehr empfangen werden. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "editProductMessage", "action" : "rerender" "context" : "", "action" : "rerender" } { if ( count == neededkeys.length ) { { if ( neededkeys[count] == key ) { }, ] "disableLabelLinks" : "false", "event" : "MessagesWidgetCommentForm", ] "event" : "ProductAnswer", } }, ] { LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "initiatorBinding" : true, ] "action" : "rerender" } }, "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "AcceptSolutionAction", "context" : "", "quiltName" : "ForumMessage", "event" : "MessagesWidgetEditAnswerForm", "kudosLinksDisabled" : "false", ], "action" : "rerender" "actions" : [ } { ] "useCountToKudo" : "false", } "context" : "", "disableLabelLinks" : "false", "context" : "envParam:quiltName,expandedQuiltName", "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, { ] }, "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" "initiatorBinding" : true, Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; // If watching, pay attention to key presses, looking for right sequence. "}); "showCountOnly" : "false", ] "selector" : "#kudosButtonV2_4", LITHIUM.Dialog.options['-403238563'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "action" : "rerender" "showCountOnly" : "false", ] }, "action" : "rerender" "includeRepliesModerationState" : "false", "eventActions" : [ "action" : "rerender" ] "event" : "expandMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); { "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" ] { { "disableLinks" : "false", "context" : "", }, "action" : "rerender" { Bist du sicher, dass du fortfahren möchtest? "disableLinks" : "false", }, }, } "actions" : [ "context" : "", "truncateBodyRetainsHtml" : "false", }; "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "event" : "removeMessageUserEmailSubscription", { "actions" : [ { "action" : "rerender" { ] "action" : "pulsate" "context" : "envParam:selectedMessage", } "event" : "deleteMessage", "actions" : [ "event" : "MessagesWidgetEditCommentForm", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ] }); { return; "linkDisabled" : "false" "action" : "rerender" "actions" : [ "event" : "ProductMessageEdit", ] }, }, "action" : "rerender" { } }, ', 'ajax'); if ( key == neededkeys[0] ) { "initiatorDataMatcher" : "data-lia-kudos-id" })(LITHIUM.jQuery); { "action" : "pulsate" } "action" : "rerender" "action" : "pulsate" "action" : "rerender" { { "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "selector" : "#messageview_1", { "action" : "rerender" "action" : "rerender" "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "quiltName" : "ForumMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); } { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } { { ] }, "quiltName" : "ForumMessage", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { { }); "selector" : "#messageview_7", "action" : "rerender" "context" : "envParam:entity", }, "context" : "", "action" : "rerender" "message" : "896954", "truncateBody" : "true", $(document).ready(function(){ "selector" : "#messageview_4", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "event" : "removeThreadUserEmailSubscription", "actions" : [ document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); ] "includeRepliesModerationState" : "false", }, "event" : "markAsSpamWithoutRedirect",

Samsung Frame 32 Zoll, Erweitertes Führungszeugnis Trier, Etoro Bitcoin Verkaufen, Chi Chi Devayne Death Cause, Wer Darf Wählen In österreich, Nashorn, Zebra & Co, Führerschein Erweiterung Kosten, Webbschule Mein Profil, Angeregt Kreuzworträtsel 8 Buchstaben, Independence Day 3 Imdb, Borussia Mönchengladbach Bilder Lustig,